PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 208aa    MW: 24006.5 Da    PI: 6.4093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0914genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.82.8e-091157346
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46
                     +W+   d+l+ +a  ++ ++    +W++Ia+ ++ g+++ +++ ++ +
      Gh_A09G0914 11 AWSWHQDKLFERALVMFSNDessdRWEKIAAQVP-GKSAADVRRHYED 57
                     8*********************************.***********76 PP

2Myb_DNA-binding44.14.8e-14111155347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
      Gh_A09G0914 111 PWTEEEHRLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 155
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.212762IPR017884SANT domain
SMARTSM007171.3E-5861IPR001005SANT/Myb domain
SuperFamilySSF466897.9E-91067IPR009057Homeodomain-like
CDDcd001675.59E-51155No hitNo description
PfamPF002491.7E-71157IPR001005SANT/Myb domain
PROSITE profilePS5129419.214104160IPR017930Myb domain
SuperFamilySSF466893.89E-17106161IPR009057Homeodomain-like
SMARTSM007172.3E-10108158IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.1E-17108158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-12108154IPR009057Homeodomain-like
CDDcd001671.09E-8111156No hitNo description
PfamPF002491.2E-11111155IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MIRTNDDASS AWSWHQDKLF ERALVMFSND ESSDRWEKIA AQVPGKSAAD VRRHYEDLEH  60
DVLEIESGRV ELPSYEGELE SASWVNESGR SQVWVGSKGK ERESERRKGV PWTEEEHRLF  120
LIGLQKYGKG DWRSISRNAV VSRTPTQVAS HAQKYFLRLN SVNEKNKKRS SIHDLKMGDD  180
NSMDPQSKFF NEQGSSFVNN HGYEFPLL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.261410.0stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5848724e-94JX584872.1 Gossypium hirsutum clone NBRI_GE18283 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485124.11e-145PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H78e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0N5391e-153A0A0B0N539_G
STRINGVIT_06s0080g00790.t011e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2056656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-61MYB family protein